PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G279700.1
Common NameB456_011G279700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 187aa    MW: 20842.6 Da    PI: 10.4795
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G279700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.41.4e-1264108347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT eE+ l++ ++k++G+g+W+ I+r +   +t+ q+ s+ qky
  Gorai.011G279700.1  64 PWTIEEHRLFLLGIKKYGKGDWRNISRNFVDSKTPTQVASHAQKY 108
                         7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3757113IPR017930Myb domain
SuperFamilySSF466892.47E-1559111IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-1560109IPR006447Myb domain, plants
SMARTSM007172.8E-961111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-1162112IPR009057Homeodomain-like
CDDcd001671.56E-964108No hitNo description
PfamPF002494.0E-1064108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MSILDIILLS IRFNKGIKKD DIWKSTVSDS SFTLELVDNN DFYACRKSSN GAKGPNHERK  60
KGIPWTIEEH RLFLLGIKKY GKGDWRNISR NFVDSKTPTQ VASHAQKYQK WKLSRGKDEK  120
KPGIHDVTVL DLTGTTVFSD DRKPPSANQS NVASQQKPAS MSKTSPNDGS ATVFGLVNGQ  180
YVKTRL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453652.11e-122PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-39DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2TEP01e-136A0A0D2TEP0_G
STRINGGLYMA02G42140.33e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3693622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.14e-38MYB family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]